Lineage for d6hdtb_ (6hdt B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2396658Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2397182Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2397183Protein automated matches [190537] (9 species)
    not a true protein
  7. 3060181Species Afifella pfennigii [TaxId:209897] [360243] (3 PDB entries)
  8. 3060223Domain d6hdtb_: 6hdt B: [360285]
    automated match to d4jnjd_
    complexed with btn

Details for d6hdtb_

PDB Entry: 6hdt (more details), 1.54 Å

PDB Description: crystal structure of short afifavidin - biotin complex
PDB Compounds: (B:) Short afifavidin

SCOPe Domain Sequences for d6hdtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hdtb_ b.61.1.0 (B:) automated matches {Afifella pfennigii [TaxId: 209897]}
msprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplvgl
twgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgsdt
ftlv

SCOPe Domain Coordinates for d6hdtb_:

Click to download the PDB-style file with coordinates for d6hdtb_.
(The format of our PDB-style files is described here.)

Timeline for d6hdtb_:

  • d6hdtb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15