Lineage for d6mxtn1 (6mxt N:6-114)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (165 PDB entries)
  8. 3060220Domain d6mxtn1: 6mxt N:6-114 [360282]
    Other proteins in same PDB: d6mxtn2, d6mxtn3
    automated match to d1vhpa_
    complexed with hto, k5y, mg, ni, ola, olc, p33

Details for d6mxtn1

PDB Entry: 6mxt (more details), 2.96 Å

PDB Description: crystal structure of human beta2 adrenergic receptor bound to salmeterol and nb71
PDB Compounds: (N:) nanobody Nb71

SCOPe Domain Sequences for d6mxtn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mxtn1 b.1.1.1 (N:6-114) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgfafssyelrwyrqapgkqhelvagittggntyyadsvkg
rftisrdnakntvylqmsnlrpedtavyacnanwdllsdywgqgtqvtv

SCOPe Domain Coordinates for d6mxtn1:

Click to download the PDB-style file with coordinates for d6mxtn1.
(The format of our PDB-style files is described here.)

Timeline for d6mxtn1:

  • d6mxtn1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15