Lineage for d6hdva_ (6hdv A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415932Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2415933Protein automated matches [190537] (10 species)
    not a true protein
  7. 2415934Species Afifella pfennigii [TaxId:209897] [360243] (3 PDB entries)
  8. 2415943Domain d6hdva_: 6hdv A: [360278]
    automated match to d4jnjd_

Details for d6hdva_

PDB Entry: 6hdv (more details), 2.16 Å

PDB Description: the crystal structure of intact afifavidin apo form
PDB Compounds: (A:) Afifavidin

SCOPe Domain Sequences for d6hdva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hdva_ b.61.1.0 (A:) automated matches {Afifella pfennigii [TaxId: 209897]}
qdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplv
gltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgs
dtftlvnkamketpkm

SCOPe Domain Coordinates for d6hdva_:

Click to download the PDB-style file with coordinates for d6hdva_.
(The format of our PDB-style files is described here.)

Timeline for d6hdva_: