Lineage for d6ewbk2 (6ewb K:110-210)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (538 PDB entries)
  8. 3060213Domain d6ewbk2: 6ewb K:110-210 [360275]
    Other proteins in same PDB: d6ewbf1, d6ewbi1, d6ewbk1, d6ewbl1
    automated match to d2fbjl2
    complexed with edo

Details for d6ewbk2

PDB Entry: 6ewb (more details), 2.78 Å

PDB Description: crystal structure of gii.4 unsw 2012 p domain in complex with fab 10e9
PDB Compounds: (K:) Fab light chain

SCOPe Domain Sequences for d6ewbk2:

Sequence, based on SEQRES records: (download)

>d6ewbk2 b.1.1.2 (K:110-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records): (download)

>d6ewbk2 b.1.1.2 (K:110-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgngvlnswtdqdskdstys
msstltltkyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d6ewbk2:

Click to download the PDB-style file with coordinates for d6ewbk2.
(The format of our PDB-style files is described here.)

Timeline for d6ewbk2:

  • d6ewbk2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15