Lineage for d6mtka1 (6mtk A:1-321)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (55 species)
    not a true protein
  7. 3060205Species Elizabethkingia anophelis [TaxId:1338011] [360267] (1 PDB entry)
  8. 3060206Domain d6mtka1: 6mtk A:1-321 [360268]
    Other proteins in same PDB: d6mtka2
    automated match to d3tzla_

Details for d6mtka1

PDB Entry: 6mtk (more details), 2 Å

PDB Description: crystal structure of tryptophanyl-trna synthetase from elizabethkingia anophelis nuhp1
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d6mtka1:

Sequence, based on SEQRES records: (download)

>d6mtka1 c.26.1.0 (A:1-321) automated matches {Elizabethkingia anophelis [TaxId: 1338011]}
mriltgiqatgtphlgnllgaiipaielakkpendslffianlhtltqikdaaqlrqnty
eiaaawlacgldtektifyrqsdipetceltwyldcffpfqrltlahsfkdkadrlqdvn
aglfnypilmaadillydaevvpvgkdqlqhleitrdvaekfnrqmgevfvlpgaeiqes
tkyvpgtdghkmsksrgniiniflpekelkkqimsiesdsksleepkdpetdktfiiyal
iatpeqtealrqkylagnfgyghaktellnlilerfakerelfsyymsnlneleeklqqg
aekarviaratldktrkvlgy

Sequence, based on observed residues (ATOM records): (download)

>d6mtka1 c.26.1.0 (A:1-321) automated matches {Elizabethkingia anophelis [TaxId: 1338011]}
mriltgiqatgtphlgnllgaiipaielakkpendslffianlhtltqikdaaqlrqnty
eiaaawlacgldtektifyrqsdipetceltwyldcffpfqrltlahsfdvnaglfnypi
lmaadillydaevvpvgkdqlqhleitrdvaekfnrqmgevfvlpgaeitkyvpgtdghk
msksrgniiniflpekelkkqimsiesdsksleepkdpetdktfiiyaliatpeqtealr
qkylagnfgyghaktellnlilerfakerelfsyymsnlneleeklqqgaekarviarat
ldktrkvlgy

SCOPe Domain Coordinates for d6mtka1:

Click to download the PDB-style file with coordinates for d6mtka1.
(The format of our PDB-style files is described here.)

Timeline for d6mtka1:

  • d6mtka1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15

View in 3D
Domains from same chain:
(mouse over for more information)
d6mtka2