Lineage for d6hmla_ (6hml A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459390Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2459391Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2459514Family c.50.1.3: Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain-like [310642] (2 proteins)
    Pfam PF05028
    Contains N- and C-terminal extensions to macrodomain, including Tyr clasp, discussed in PubMed 22609859
  6. 2459515Protein Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain [310785] (3 species)
  7. 2459516Species Human (Homo sapiens) [TaxId:9606] [324080] (6 PDB entries)
  8. 3060180Domain d6hmla_: 6hml A: [360242]
    automated match to d4fc2d_
    complexed with 73l, dms, gol, so4

Details for d6hmla_

PDB Entry: 6hml (more details), 2.25 Å

PDB Description: polyadpribosyl glycosidase in complex with pdd00017299
PDB Compounds: (A:) Poly(ADP-ribose) glycohydrolase

SCOPe Domain Sequences for d6hmla_:

Sequence, based on SEQRES records: (download)

>d6hmla_ c.50.1.3 (A:) Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
pdkkwlgtpieemrrmprcgirlpllrpsanhtvtirvdllragevpkpfpthykdlwdn
khvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvayskkw
dftalidfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllaaamnhsitmsqe
qiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfxyfrrvta
aaptglvtftrqsledfpewercekpltrlhvtyegtieengqgmlqvdfanrfvgggvt
saglvqeeirflinpeliisrlftevldhnecliitgteqyseytgyaetyrwsrshedg
serddwqrrcteivaidalhfrryldqfvpekmrrelnkaycgflrpgvssenlsavatg
nwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhiflterkltvgdv
yklllryyneecrncstpgpdiklypfiyhavesc

Sequence, based on observed residues (ATOM records): (download)

>d6hmla_ c.50.1.3 (A:) Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
pdkkwlgtpieemrrirlpllrpsanhtvtirvdllragevpkpfpthykdlwdnkhvkm
pcseqnlypvtagsrweliqtallnkftrpqnlkdailkynvayskkwdftalidfwdkv
leeaeaqhlyqsilpdmvkialclpnictqpipllaaamnhsitmsqeqiasllanaffc
tfprrnakmkseyssypdinfnrlfegrssrkpeklktlfxyfrrvtaaaptglvtftrq
sledfpewercekpltrlhvtyegtieengqgmlqvdfanrfvgggvtsaglvqeeirfl
inpeliisrlftevldhnecliitgteqyseytgyaetyrwsrshedgserddwqrrcte
ivaidalhfrryldqfvpekmrrelnkaycgflrpgvssenlsavatgnwgcgafggdar
lkaliqilaaaaaerdvvyftfgdselmrdiysmhiflterkltvgdvyklllryyneec
rncstpdiklypfiyhavesc

SCOPe Domain Coordinates for d6hmla_:

Click to download the PDB-style file with coordinates for d6hmla_.
(The format of our PDB-style files is described here.)

Timeline for d6hmla_:

  • d6hmla_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15