Lineage for d6cvlb_ (6cvl B:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2581051Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 2581052Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 2581053Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 2581087Protein automated matches [191243] (2 species)
    not a true protein
  7. 2581088Species Escherichia coli K-12 [TaxId:83333] [189709] (9 PDB entries)
  8. 3060175Domain d6cvlb_: 6cvl B: [360237]
    Other proteins in same PDB: d6cvlc1, d6cvlc2, d6cvlc3, d6cvld1, d6cvld2, d6cvld3
    automated match to d3tuia_
    complexed with ags, hg, iod

Details for d6cvlb_

PDB Entry: 6cvl (more details), 2.95 Å

PDB Description: crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein
PDB Compounds: (B:) MetI transmembrane subunit

SCOPe Domain Sequences for d6cvlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvlb_ f.58.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
msepmmwllvrgvwetlamtfvsgffgfviglpvgvllyvtrpgqiianaklyrtvsaiv
nifrsipfiillvwmipftrvivgtsiglqaaivpltvgaapfiarmvenalleiptgli
easramgatpmqivrkvllpealpglvnaatitlitlvgysamggavgagglgqigyqyg
yigynatvmntvlvllvilvyliqfagdrivravt

SCOPe Domain Coordinates for d6cvlb_:

Click to download the PDB-style file with coordinates for d6cvlb_.
(The format of our PDB-style files is described here.)

Timeline for d6cvlb_:

  • d6cvlb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15