Lineage for d6h73a_ (6h73 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2478893Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2478894Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2479047Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2479048Protein automated matches [190728] (15 species)
    not a true protein
  7. 2479055Species Azotobacter vinelandii [TaxId:354] [194940] (7 PDB entries)
  8. 3060172Domain d6h73a_: 6h73 A: [360234]
    automated match to d2ogxa_
    complexed with atp, fuq, guh, mg, moo, po4

Details for d6h73a_

PDB Entry: 6h73 (more details), 2.3 Å

PDB Description: molybdenum storage protein - recombinantly produced and loaded with molybdate under in vitro conditions
PDB Compounds: (A:) Molybdenum storage protein subunit alpha

SCOPe Domain Sequences for d6h73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h73a_ c.73.1.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
krpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvg
ldlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsa
fppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarfl
petsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirt
gvrpa

SCOPe Domain Coordinates for d6h73a_:

Click to download the PDB-style file with coordinates for d6h73a_.
(The format of our PDB-style files is described here.)

Timeline for d6h73a_:

  • d6h73a_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15