Lineage for d6fywc_ (6fyw C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (170 PDB entries)
  8. 3060167Domain d6fywc_: 6fyw C: [360229]
    automated match to d5hggs_
    complexed with bma, gol, man, nag

Details for d6fywc_

PDB Entry: 6fyw (more details), 2.2 Å

PDB Description: structure of b/brisbane/60/2008 influenza hemagglutinin in complex with sd83
PDB Compounds: (C:) Single domain antibody SD83

SCOPe Domain Sequences for d6fywc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fywc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqpggslrlscaatgftlenkaigwfrqtpgseregvlcisksgswtyy
tdsmrgrftisrdnaentvylqmdslkpedtavyycatttaggglcwdgttfsrlasswg
qgtqvtvss

SCOPe Domain Coordinates for d6fywc_:

Click to download the PDB-style file with coordinates for d6fywc_.
(The format of our PDB-style files is described here.)

Timeline for d6fywc_:

  • d6fywc_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15