Lineage for d6ck8c_ (6ck8 C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (166 PDB entries)
  8. 3060163Domain d6ck8c_: 6ck8 C: [360225]
    automated match to d5j1sc_
    complexed with 1pe, gol, so4

Details for d6ck8c_

PDB Entry: 6ck8 (more details), 2.05 Å

PDB Description: crystal structure of anti-influenza single-domain llama antibody sd38
PDB Compounds: (C:) Llama antibody SD38

SCOPe Domain Sequences for d6ck8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ck8c_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqpggslrlscavsisifdiyamdwyrqapgkqrdlvatsfrdgstnya
dsvkgrftisrdnakntlylqmnslkpedtavylchvslyrdplgvaggmgvywgkgalv
tvss

SCOPe Domain Coordinates for d6ck8c_:

Click to download the PDB-style file with coordinates for d6ck8c_.
(The format of our PDB-style files is described here.)

Timeline for d6ck8c_:

  • d6ck8c_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15