Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
Domain d6ck8c_: 6ck8 C: [360225] automated match to d5j1sc_ complexed with 1pe, gol, so4 |
PDB Entry: 6ck8 (more details), 2.05 Å
SCOPe Domain Sequences for d6ck8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ck8c_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]} evqlvesggglvqpggslrlscavsisifdiyamdwyrqapgkqrdlvatsfrdgstnya dsvkgrftisrdnakntlylqmnslkpedtavylchvslyrdplgvaggmgvywgkgalv tvss
Timeline for d6ck8c_: