Lineage for d6eula_ (6eul A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (106 species)
    not a true protein
  7. 2476710Species Human (Homo sapiens) [TaxId:9606] [188340] (82 PDB entries)
  8. 3060141Domain d6eula_: 6eul A: [360203]
    automated match to d4tpka_
    complexed with by2, edo, nag

Details for d6eula_

PDB Entry: 6eul (more details), 2.6 Å

PDB Description: butyrylcolinesterase expressed in cho cells co-crystallised with a rivastigmine analogue
PDB Compounds: (A:) cholinesterase

SCOPe Domain Sequences for d6eula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eula_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkya
nsccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgt
sslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqkni
aafggnpksvtlfgexagaasvslhllspgshslftrailqsgsfnapwavtslyearnr
tlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdm
pdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvs
efgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfe
hrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpne
tennstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkvl

SCOPe Domain Coordinates for d6eula_:

Click to download the PDB-style file with coordinates for d6eula_.
(The format of our PDB-style files is described here.)

Timeline for d6eula_:

  • d6eula_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15