Lineage for d6e41a1 (6e41 A:15-402)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343809Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2343810Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2343820Family a.266.1.2: Indoleamine 2,3-dioxygenase-like [140963] (3 proteins)
    Pfam PF01231; contains extra N-terminal all-alpha subdomain of similar fold to the GST C-terminal domain (47615)
  6. 2343830Protein automated matches [190585] (2 species)
    not a true protein
  7. 2343831Species Human (Homo sapiens) [TaxId:9606] [187592] (30 PDB entries)
  8. 3060133Domain d6e41a1: 6e41 A:15-402 [360195]
    Other proteins in same PDB: d6e41a2, d6e41b2, d6e41c2, d6e41d2
    automated match to d5wmxb_
    complexed with hem, hqs

Details for d6e41a1

PDB Entry: 6e41 (more details), 2.29 Å

PDB Description: crystal structure of human indoleamine 2,3-dioxygenase 1 (ido1) in complex with ferric heme and an epacadostat analog
PDB Compounds: (A:) Indoleamine 2,3-dioxygenase 1

SCOPe Domain Sequences for d6e41a1:

Sequence, based on SEQRES records: (download)

>d6e41a1 a.266.1.2 (A:15-402) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhk
sqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlsaalelppilvyadcvlanw
kkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerd
tllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwe
dpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnp
svrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsedpskl
eakgtggtdlmnflktvrstteksllke

Sequence, based on observed residues (ATOM records): (download)

>d6e41a1 a.266.1.2 (A:15-402) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhltdhk
sqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlsaalelppilvyadcvlanw
kkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerd
tllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwe
dpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcslesnp
svrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqkleakgtggtdlmn
flktvrstteksllke

SCOPe Domain Coordinates for d6e41a1:

Click to download the PDB-style file with coordinates for d6e41a1.
(The format of our PDB-style files is described here.)

Timeline for d6e41a1:

  • d6e41a1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15