Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
Family c.23.14.0: automated matches [191355] (1 protein) not a true family |
Protein automated matches [190390] (4 species) not a true protein |
Species Bacillus psychrosaccharolyticus [TaxId:1407] [360185] (1 PDB entry) |
Domain d6evsa_: 6evs A: [360192] automated match to d1s2da_ |
PDB Entry: 6evs (more details), 1.9 Å
SCOPe Domain Sequences for d6evsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6evsa_ c.23.14.0 (A:) automated matches {Bacillus psychrosaccharolyticus [TaxId: 1407]} akiylaspffneeqlkhvskaeqvlrdlghtvfsprenqlpevefgsfewrtfvfkndle hikwaditfgiigdnyddtgtawelgasyilgkpvmlfsptgeiinlmitdslhayfedw ndvenydfatlpikpyl
Timeline for d6evsa_: