Lineage for d6evsa_ (6evs A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858401Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2858647Family c.23.14.0: automated matches [191355] (1 protein)
    not a true family
  6. 2858648Protein automated matches [190390] (4 species)
    not a true protein
  7. 2858649Species Bacillus psychrosaccharolyticus [TaxId:1407] [360185] (1 PDB entry)
  8. 2858650Domain d6evsa_: 6evs A: [360192]
    automated match to d1s2da_

Details for d6evsa_

PDB Entry: 6evs (more details), 1.9 Å

PDB Description: characterization of 2-deoxyribosyltransferase from psychrotolerant bacterium bacillus psychrosaccharolyticus: a suitable biocatalyst for the industrial synthesis of antiviral and antitumoral nucleosides
PDB Compounds: (A:) N-deoxyribosyltransferase

SCOPe Domain Sequences for d6evsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6evsa_ c.23.14.0 (A:) automated matches {Bacillus psychrosaccharolyticus [TaxId: 1407]}
akiylaspffneeqlkhvskaeqvlrdlghtvfsprenqlpevefgsfewrtfvfkndle
hikwaditfgiigdnyddtgtawelgasyilgkpvmlfsptgeiinlmitdslhayfedw
ndvenydfatlpikpyl

SCOPe Domain Coordinates for d6evsa_:

Click to download the PDB-style file with coordinates for d6evsa_.
(The format of our PDB-style files is described here.)

Timeline for d6evsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6evsb_