Lineage for d6ewka_ (6ewk A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474357Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2474358Protein Acetylcholinesterase [53476] (6 species)
  7. 2474462Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (95 PDB entries)
    Uniprot P04058 25-556
  8. 3060129Domain d6ewka_: 6ewk A: [360191]
    automated match to d1jjba_
    complexed with 1pe, nag, rm0

Details for d6ewka_

PDB Entry: 6ewk (more details), 2.22 Å

PDB Description: t. californica ache in complex with a 3-hydroxy-2-pyridine aldoxime.
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d6ewka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ewka_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOPe Domain Coordinates for d6ewka_:

Click to download the PDB-style file with coordinates for d6ewka_.
(The format of our PDB-style files is described here.)

Timeline for d6ewka_:

  • d6ewka_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15