Lineage for d1hfem1 (1hfe M:87-398)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525681Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 2525682Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
    automatically mapped to Pfam PF02906
  5. 2525683Family c.96.1.1: Fe-only hydrogenase [53921] (3 proteins)
  6. 2525684Protein Fe-only hydrogenase larger subunit, C-domain [53924] (1 species)
  7. 2525685Species Desulfovibrio desulfuricans [TaxId:876] [53925] (1 PDB entry)
  8. 2525687Domain d1hfem1: 1hfe M:87-398 [36019]
    Other proteins in same PDB: d1hfel2, d1hfem2, d1hfes_, d1hfet_
    complexed with cmo, cyn, cys, fe2, pdt, sf4, zn

Details for d1hfem1

PDB Entry: 1hfe (more details), 1.6 Å

PDB Description: 1.6 a resolution structure of the fe-only hydrogenase from desulfovibrio desulfuricans
PDB Compounds: (M:) protein (fe-only hydrogenase (e.c.1.18.99.1) (larger subunit))

SCOPe Domain Sequences for d1hfem1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfem1 c.96.1.1 (M:87-398) Fe-only hydrogenase larger subunit, C-domain {Desulfovibrio desulfuricans [TaxId: 876]}
wvpevekklkdgkvkciampapavryalgdafgmpvgsvttgkmlaalqklgfahcwdte
ftadvtiweegsefverltkksdmplpqftsccpgwqkyaetyypellphfstckspigm
ngalaktygaermkydpkqvytvsimpciakkyeglrpelkssgmrdidatlttrelaym
ikkagidfaklpdgkrdslmgestggatifgvtggvmeaalrfayeavtgkkpdswdfka
vrgldgikeatvnvggtdvkvavvhgakrfkqvcddvkagkspyhfieymacpggcvcgg
gqpvmpgvleam

SCOPe Domain Coordinates for d1hfem1:

Click to download the PDB-style file with coordinates for d1hfem1.
(The format of our PDB-style files is described here.)

Timeline for d1hfem1: