Lineage for d1hfem1 (1hfe M:87-398)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186721Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
  4. 186722Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
  5. 186723Family c.96.1.1: Fe-only hydrogenase [53921] (2 proteins)
  6. 186724Protein Fe-only hydrogenase larger subunit, C-domain [53924] (1 species)
  7. 186725Species Desulfovibrio desulfuricans [TaxId:876] [53925] (1 PDB entry)
  8. 186727Domain d1hfem1: 1hfe M:87-398 [36019]
    Other proteins in same PDB: d1hfel2, d1hfem2, d1hfes_, d1hfet_

Details for d1hfem1

PDB Entry: 1hfe (more details), 1.6 Å

PDB Description: 1.6 a resolution structure of the fe-only hydrogenase from desulfovibrio desulfuricans

SCOP Domain Sequences for d1hfem1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfem1 c.96.1.1 (M:87-398) Fe-only hydrogenase larger subunit, C-domain {Desulfovibrio desulfuricans}
wvpevekklkdgkvkciampapavryalgdafgmpvgsvttgkmlaalqklgfahcwdte
ftadvtiweegsefverltkksdmplpqftsccpgwqkyaetyypellphfstckspigm
ngalaktygaermkydpkqvytvsimpciakkyeglrpelkssgmrdidatlttrelaym
ikkagidfaklpdgkrdslmgestggatifgvtggvmeaalrfayeavtgkkpdswdfka
vrgldgikeatvnvggtdvkvavvhgakrfkqvcddvkagkspyhfieymacpggcvcgg
gqpvmpgvleam

SCOP Domain Coordinates for d1hfem1:

Click to download the PDB-style file with coordinates for d1hfem1.
(The format of our PDB-style files is described here.)

Timeline for d1hfem1: