SCOPe 2.08: Domain d6evsb_: 6evs B:

Lineage for d6evsb_ (6evs B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.0: automated matches [191355] (1 protein)
   not a true family

6. Protein automated matches [190390] (4 species)
   not a true protein

7. Species Bacillus psychrosaccharolyticus [TaxId:1407] [360185] (1 PDB entry)

8. Domain d6evsb_: 6evs B: [360186]
   automated match to d1s2da_

Details for d6evsb_

PDB Entry: 6evs, 1.9 Å

PDB Description: characterization of 2-deoxyribosyltransferase from psychrotolerant bacterium bacillus psychrosaccharolyticus: a suitable biocatalyst for the industrial synthesis of antiviral and antitumoral nucleosides

PDB Compounds: (B:) N-deoxyribosyltransferase

SCOPe Domain Sequences for d6evsb_:

Sequence; same for both SEQRES and ATOM records:

>d6evsb_ c.23.14.0 (B:) automated matches {Bacillus psychrosaccharolyticus [TaxId: 1407]}
akiylaspffneeqlkhvskaeqvlrdlghtvfsprenqlpevefgsfewrtfvfkndle
hikwaditfgiigdnyddtgtawelgasyilgkpvmlfsptgeiinlmitdslhayfedw
ndvenydfatlpikpyl

Timeline for d6evsb_:

• d6evsb_ first appeared in SCOPe 2.07