Lineage for d1hfel1 (1hfe L:87-398)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322511Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 322512Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
  5. 322513Family c.96.1.1: Fe-only hydrogenase [53921] (2 proteins)
  6. 322514Protein Fe-only hydrogenase larger subunit, C-domain [53924] (1 species)
  7. 322515Species Desulfovibrio desulfuricans [TaxId:876] [53925] (1 PDB entry)
  8. 322516Domain d1hfel1: 1hfe L:87-398 [36018]
    Other proteins in same PDB: d1hfel2, d1hfem2, d1hfes_, d1hfet_

Details for d1hfel1

PDB Entry: 1hfe (more details), 1.6 Å

PDB Description: 1.6 a resolution structure of the fe-only hydrogenase from desulfovibrio desulfuricans

SCOP Domain Sequences for d1hfel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfel1 c.96.1.1 (L:87-398) Fe-only hydrogenase larger subunit, C-domain {Desulfovibrio desulfuricans}
wvpevekklkdgkvkciampapavryalgdafgmpvgsvttgkmlaalqklgfahcwdte
ftadvtiweegsefverltkksdmplpqftsccpgwqkyaetyypellphfstckspigm
ngalaktygaermkydpkqvytvsimpciakkyeglrpelkssgmrdidatlttrelaym
ikkagidfaklpdgkrdslmgestggatifgvtggvmeaalrfayeavtgkkpdswdfka
vrgldgikeatvnvggtdvkvavvhgakrfkqvcddvkagkspyhfieymacpggcvcgg
gqpvmpgvleam

SCOP Domain Coordinates for d1hfel1:

Click to download the PDB-style file with coordinates for d1hfel1.
(The format of our PDB-style files is described here.)

Timeline for d1hfel1: