Lineage for d6cmpa3 (6cmp A:219-527)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2455001Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2455002Protein automated matches [190475] (9 species)
    not a true protein
  7. 2455014Species Human (Homo sapiens) [TaxId:9606] [187400] (125 PDB entries)
  8. 3060108Domain d6cmpa3: 6cmp A:219-527 [360170]
    Other proteins in same PDB: d6cmpa1, d6cmpa2, d6cmpb1, d6cmpb2
    automated match to d2b3oa3
    mutant

Details for d6cmpa3

PDB Entry: 6cmp (more details), 1.8 Å

PDB Description: closed structure of inactive shp2 mutant c459e
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6cmpa3:

Sequence, based on SEQRES records: (download)

>d6cmpa3 c.45.1.0 (A:219-527) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr
yknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv
ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
esagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
qhyietlqr

Sequence, based on observed residues (ATOM records): (download)

>d6cmpa3 c.45.1.0 (A:219-527) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklakqgfweefetlqqqeckllysrkegqrqenknknryknilp
fdhtrvvlhdgvsdyinaniimpefetksyiatqgclqntvndfwrmvfqensrvivmtt
kkcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtwp
dhgvpsdpggvldfleevhhkqesimdagpvvvhesagigrtgtfividilidiirekgv
dcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqr

SCOPe Domain Coordinates for d6cmpa3:

Click to download the PDB-style file with coordinates for d6cmpa3.
(The format of our PDB-style files is described here.)

Timeline for d6cmpa3:

  • d6cmpa3 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15