Lineage for d6dnba_ (6dnb A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2470825Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2470885Protein Aspartate aminotransferase, AAT [53385] (9 species)
  7. 2471029Species Human (Homo sapiens) [TaxId:9606] [346320] (4 PDB entries)
  8. 3060104Domain d6dnba_: 6dnb A: [360166]
    automated match to d3wzfa_
    complexed with gol, pg4, po4; mutant

Details for d6dnba_

PDB Entry: 6dnb (more details), 1.7 Å

PDB Description: crystal structure of t110a:s256a mutant human glutamate oxaloacetate transaminase 1 (got1)
PDB Compounds: (A:) Aspartate aminotransferase, cytoplasmic

SCOPe Domain Sequences for d6dnba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dnba_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Human (Homo sapiens) [TaxId: 9606]}
ppsvfaevpqaqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkia
ndnslnheylpilglaefrscasrlalgddspalkekrvggvqslggagalrigadflar
wyngtnnkntpvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenap
efsivvlhacahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawair
yfvsegfeffcaqafsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaq
garivastlsnpelfeewtgnvktmadriltmrselrarlealktpgtwihitdqigmfs
ftglnpkqveylvnekhiyllpsgrinvsglttknldyvatsiheavtkiq

SCOPe Domain Coordinates for d6dnba_:

Click to download the PDB-style file with coordinates for d6dnba_.
(The format of our PDB-style files is described here.)

Timeline for d6dnba_:

  • d6dnba_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15