Lineage for d6bkib_ (6bki B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497141Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2497167Protein (Pro)cathepsin K [54028] (3 species)
  7. 2497229Species Mouse (Mus musculus) [TaxId:10090] [328741] (2 PDB entries)
  8. 3060103Domain d6bkib_: 6bki B: [360165]
    automated match to d5t6ua_
    complexed with so4

Details for d6bkib_

PDB Entry: 6bki (more details), 2.94 Å

PDB Description: crystal structure of t101a variant mouse cathepsin k at 2.94 angstrom resolution.
PDB Compounds: (B:) cathepsin k

SCOPe Domain Sequences for d6bkib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bkib_ d.3.1.1 (B:) (Pro)cathepsin K {Mouse (Mus musculus) [TaxId: 10090]}
vpdsidyrkkgyvtpvknqgqcgscwafssagalegqlkkktgkllalspqnlvdcvten
ygcgggymttafqyvqqnggidsedaypyvgqdescmynaaakaakcrgyreipvgneka
lkravarvgpisvsidaslasfqfysrgvyydencdrdnvnhavlvvgygtqkgskhwii
knswgeswgnkgyallarnknnacgitnmasfpkm

SCOPe Domain Coordinates for d6bkib_:

Click to download the PDB-style file with coordinates for d6bkib_.
(The format of our PDB-style files is described here.)

Timeline for d6bkib_:

  • d6bkib_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15