Lineage for d6bqaa_ (6bqa A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (13 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (753 PDB entries)
  8. 3060101Domain d6bqaa_: 6bqa A: [360163]
    automated match to d4nqna_
    complexed with 67c

Details for d6bqaa_

PDB Entry: 6bqa (more details), 1.03 Å

PDB Description: brd9 bromodomain in complex with 3-(6-(but-3-en-1-yl)-7-oxo-6,7- dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)-n,n-dimethylbenzamide
PDB Compounds: (A:) Bromodomain-containing protein 9

SCOPe Domain Sequences for d6bqaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bqaa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmsk

SCOPe Domain Coordinates for d6bqaa_:

Click to download the PDB-style file with coordinates for d6bqaa_.
(The format of our PDB-style files is described here.)

Timeline for d6bqaa_:

  • d6bqaa_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15