Lineage for d1c4ca1 (1c4c A:210-574)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28498Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
  4. 28499Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
  5. 28500Family c.96.1.1: Fe-only hydrogenase [53921] (2 proteins)
  6. 28505Protein Fe-only hydrogenase, catalytic domain [53922] (1 species)
  7. 28506Species Clostridium pasteurianum [TaxId:1501] [53923] (3 PDB entries)
  8. 28508Domain d1c4ca1: 1c4c A:210-574 [36016]
    Other proteins in same PDB: d1c4ca2, d1c4ca3

Details for d1c4ca1

PDB Entry: 1c4c (more details), 2.4 Å

PDB Description: binding of exogenously added carbon monoxide at the active site of the fe-only hydrogenase (cpi) from clostridium pasteurianum

SCOP Domain Sequences for d1c4ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4ca1 c.96.1.1 (A:210-574) Fe-only hydrogenase, catalytic domain {Clostridium pasteurianum}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykk

SCOP Domain Coordinates for d1c4ca1:

Click to download the PDB-style file with coordinates for d1c4ca1.
(The format of our PDB-style files is described here.)

Timeline for d1c4ca1: