Lineage for d6df7b_ (6df7 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (12 species)
    not a true protein
  7. 3060090Species Oryctolagus cuniculus [TaxId:9986] [360152] (1 PDB entry)
  8. 3060092Domain d6df7b_: 6df7 B: [360154]
    automated match to d3uv2a_
    complexed with g9v

Details for d6df7b_

PDB Entry: 6df7 (more details), 2 Å

PDB Description: taf1-bd2 in complex with cpd27 (6-(but-3-en-1-yl)-4-(1-methyl-6- (morpholine-4-carbonyl)-1h-benzo[d]imidazol-4-yl)-1,6-dihydro-7h- pyrrolo[2,3-c]pyridin-7-one)
PDB Compounds: (B:) Transcription initiation factor TFIID subunit

SCOPe Domain Sequences for d6df7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6df7b_ a.29.2.0 (B:) automated matches {Oryctolagus cuniculus [TaxId: 9986]}
dddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkniskh
kyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdict
a

SCOPe Domain Coordinates for d6df7b_:

Click to download the PDB-style file with coordinates for d6df7b_.
(The format of our PDB-style files is described here.)

Timeline for d6df7b_:

  • d6df7b_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15