Lineage for d6cmra3 (6cmr A:219-528)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2455001Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2455002Protein automated matches [190475] (9 species)
    not a true protein
  7. 2455014Species Human (Homo sapiens) [TaxId:9606] [187400] (125 PDB entries)
  8. 3060089Domain d6cmra3: 6cmr A:219-528 [360151]
    Other proteins in same PDB: d6cmra1, d6cmra2
    automated match to d2b3oa3
    complexed with 5od; mutant

Details for d6cmra3

PDB Entry: 6cmr (more details), 2.21 Å

PDB Description: closed structure of active shp2 mutant e76d bound to shp099 inhibitor
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6cmra3:

Sequence, based on SEQRES records: (download)

>d6cmra3 c.45.1.0 (A:219-528) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr
yknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv
ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
qhyietlqrr

Sequence, based on observed residues (ATOM records): (download)

>d6cmra3 c.45.1.0 (A:219-528) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelskqgfweefetlqqqeckllysrkegqrqenknknryknilpfdh
trvvlhsdyinaniimpekksyiatqgclqntvndfwrmvfqensrvivmttkevergks
kcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtwpd
hgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiirekgvd
cdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrr

SCOPe Domain Coordinates for d6cmra3:

Click to download the PDB-style file with coordinates for d6cmra3.
(The format of our PDB-style files is described here.)

Timeline for d6cmra3:

  • d6cmra3 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15