Lineage for d1feha1 (1feh A:210-574)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75699Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
  4. 75700Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
  5. 75701Family c.96.1.1: Fe-only hydrogenase [53921] (2 proteins)
  6. 75706Protein Fe-only hydrogenase, catalytic domain [53922] (1 species)
  7. 75707Species Clostridium pasteurianum [TaxId:1501] [53923] (3 PDB entries)
  8. 75708Domain d1feha1: 1feh A:210-574 [36015]
    Other proteins in same PDB: d1feha2, d1feha3

Details for d1feha1

PDB Entry: 1feh (more details), 1.8 Å

PDB Description: fe-only hydrogenase from clostridium pasteurianum

SCOP Domain Sequences for d1feha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feha1 c.96.1.1 (A:210-574) Fe-only hydrogenase, catalytic domain {Clostridium pasteurianum}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykk

SCOP Domain Coordinates for d1feha1:

Click to download the PDB-style file with coordinates for d1feha1.
(The format of our PDB-style files is described here.)

Timeline for d1feha1: