Lineage for d6cvld2 (6cvl D:241-343)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2520976Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2521161Family d.58.18.13: NIL domain-like [160322] (2 proteins)
    Pfam PF09383
  6. 2521162Protein Methionine import ATP-binding protein MetN [160323] (2 species)
  7. 2521163Species Escherichia coli [TaxId:562] [160325] (3 PDB entries)
    Uniprot P30750 241-343! Uniprot P30750 247-343
  8. 3060074Domain d6cvld2: 6cvl D:241-343 [360136]
    Other proteins in same PDB: d6cvla_, d6cvlb_, d6cvlc1, d6cvlc3, d6cvld1, d6cvld3
    automated match to d3dhwc2
    complexed with ags, hg, iod

Details for d6cvld2

PDB Entry: 6cvl (more details), 2.95 Å

PDB Description: crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein
PDB Compounds: (D:) MetN nucleotide-binding subunit

SCOPe Domain Sequences for d6cvld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvld2 d.58.18.13 (D:241-343) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}
iqstlhldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnaiisaq
mdyaggvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyv

SCOPe Domain Coordinates for d6cvld2:

Click to download the PDB-style file with coordinates for d6cvld2.
(The format of our PDB-style files is described here.)

Timeline for d6cvld2:

  • d6cvld2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15