Lineage for d6bjzl2 (6bjz L:111-215)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (831 PDB entries)
  8. 3060072Domain d6bjzl2: 6bjz L:111-215 [360134]
    Other proteins in same PDB: d6bjzl1
    automated match to d1dn0a2
    complexed with dv7

Details for d6bjzl2

PDB Entry: 6bjz (more details), 1.45 Å

PDB Description: crystal structure of the fab fragment of humanized 5c8 antibody containing the fluorescent non-canonical amino acid l-(7- hydroxycoumarin-4-yl)ethylglycine at ph 5.5
PDB Compounds: (L:) 5c8 Fab Light chain

SCOPe Domain Sequences for d6bjzl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bjzl2 b.1.1.2 (L:111-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d6bjzl2:

Click to download the PDB-style file with coordinates for d6bjzl2.
(The format of our PDB-style files is described here.)

Timeline for d6bjzl2:

  • d6bjzl2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-15