Lineage for d6bjpb_ (6bjp B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (56 species)
    not a true protein
  7. 3058138Species Pseudomonas aeruginosa [TaxId:208964] [358200] (3 PDB entries)
  8. 3060064Domain d6bjpb_: 6bjp B: [360126]
    automated match to d2xdra_
    complexed with edo, gol, k; mutant

Details for d6bjpb_

PDB Entry: 6bjp (more details), 2.1 Å

PDB Description: apo form of the e124s mutant of betaine aldehyde dehydrogenase from pseudomonas aeruginosa
PDB Compounds: (B:) NAD/NADP-dependent betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d6bjpb_:

Sequence, based on SEQRES records: (download)

>d6bjpb_ c.82.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
aisgeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
elgdyasvf

Sequence, based on observed residues (ATOM records): (download)

>d6bjpb_ c.82.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
aisgeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftglggkspliifpd
adldraadiavmanffssgqvctngtrvfihrsqqarfeakvlervqrirlgdpqdentn
fgplvsfphmesvlgyiesgkaqkarllcggervtdgafgkgayvaptvftdcrddmtiv
reeifgpvmsilvyddedeairrandteyglaagvvtqdlarahraihrleagicwintw
gespaempvggykqsgvgrenglttlahytriksvqvelgdyasvf

SCOPe Domain Coordinates for d6bjpb_:

Click to download the PDB-style file with coordinates for d6bjpb_.
(The format of our PDB-style files is described here.)

Timeline for d6bjpb_:

  • d6bjpb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-15