Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein automated matches [190169] (7 species) not a true protein |
Species Debaryomyces nepalensis [TaxId:27299] [360097] (2 PDB entries) |
Domain d5zcma1: 5zcm A:1-320 [360113] Other proteins in same PDB: d5zcma2 automated match to d1mi3a_ complexed with dtt, ndp |
PDB Entry: 5zcm (more details), 1.7 Å
SCOPe Domain Sequences for d5zcma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zcma1 c.1.7.1 (A:1-320) automated matches {Debaryomyces nepalensis [TaxId: 27299]} msiklnsgyemplvgfgcwkvdnatcadtvynaikvgyrlfdaamdygnckeigeginra ldeglvardelfitsklwnsyhdpknvelalkkvlsdmkldyidlflihfpiafkfvpfe ekyppafycgdgdnfhyedvplletwkamekltkggkaksigisnfsaaliydllrgaei kpavlqiehhpylqqprlieyvqsqgiaitayssfgpqsflelkhskaldtptlfehkti tsiadkykktpaqvllrwasqrdiaiipksnnpdrllqnlevndfnlskedfdeiskldq dlrfnnpwdwdtknripifa
Timeline for d5zcma1: