Lineage for d5zcia_ (5zci A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415941Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2415942Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2416303Protein automated matches [190169] (7 species)
    not a true protein
  7. 3060035Species Debaryomyces nepalensis [TaxId:27299] [360097] (2 PDB entries)
  8. 3060045Domain d5zcia_: 5zci A: [360107]
    Other proteins in same PDB: d5zcib2
    automated match to d1mi3a_

Details for d5zcia_

PDB Entry: 5zci (more details), 2 Å

PDB Description: crystal structure of apo form of xylose reductase from debaryomyces nepalensis
PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d5zcia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcia_ c.1.7.1 (A:) automated matches {Debaryomyces nepalensis [TaxId: 27299]}
msiklnsgyemplvgfgcwkvdnatcadtvynaikvgyrlfdaamdygnckeigeginra
ldeglvardelfitsklwnsyhdpknvelalkkvlsdmkldyidlflihfpiafkfvpfe
ekyppafycgdgdnfhyedvplletwkamekltkggkaksigisnfsaaliydllrgaei
kpavlqiehhpylqqprlieyvqsqgiaitayssfgpqsflelkhskaldtptlfehkti
tsiadkykktpaqvllrwasqrdiaiipksnnpdrllqnlevndfnlskedfdeiskldq
dlrfnnpwdwdtknripifa

SCOPe Domain Coordinates for d5zcia_:

Click to download the PDB-style file with coordinates for d5zcia_.
(The format of our PDB-style files is described here.)

Timeline for d5zcia_:

  • d5zcia_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08