SCOPe 2.08: Domain d5zcib1: 5zci B:1-320

Lineage for d5zcib1 (5zci B:1-320)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein automated matches [190169] (7 species)
   not a true protein

7. Species Debaryomyces nepalensis [TaxId:27299] [360097] (2 PDB entries)

8. Domain d5zcib1: 5zci B:1-320 [360098]
   Other proteins in same PDB: d5zcib2
   automated match to d1mi3a_

Details for d5zcib1

PDB Entry: 5zci, 2 Å

PDB Description: crystal structure of apo form of xylose reductase from debaryomyces nepalensis

PDB Compounds: (B:) aldose reductase

SCOPe Domain Sequences for d5zcib1:

Sequence; same for both SEQRES and ATOM records:

>d5zcib1 c.1.7.1 (B:1-320) automated matches {Debaryomyces nepalensis [TaxId: 27299]}
msiklnsgyemplvgfgcwkvdnatcadtvynaikvgyrlfdaamdygnckeigeginra
ldeglvardelfitsklwnsyhdpknvelalkkvlsdmkldyidlflihfpiafkfvpfe
ekyppafycgdgdnfhyedvplletwkamekltkggkaksigisnfsaaliydllrgaei
kpavlqiehhpylqqprlieyvqsqgiaitayssfgpqsflelkhskaldtptlfehkti
tsiadkykktpaqvllrwasqrdiaiipksnnpdrllqnlevndfnlskedfdeiskldq
dlrfnnpwdwdtknripifa

Timeline for d5zcib1:

• d5zcib1 first appeared in SCOPe 2.07