Lineage for d5zcib1 (5zci B:1-320)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415941Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2415942Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2416303Protein automated matches [190169] (7 species)
    not a true protein
  7. 3060035Species Debaryomyces nepalensis [TaxId:27299] [360097] (2 PDB entries)
  8. 3060036Domain d5zcib1: 5zci B:1-320 [360098]
    Other proteins in same PDB: d5zcib2
    automated match to d1mi3a_

Details for d5zcib1

PDB Entry: 5zci (more details), 2 Å

PDB Description: crystal structure of apo form of xylose reductase from debaryomyces nepalensis
PDB Compounds: (B:) aldose reductase

SCOPe Domain Sequences for d5zcib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcib1 c.1.7.1 (B:1-320) automated matches {Debaryomyces nepalensis [TaxId: 27299]}
msiklnsgyemplvgfgcwkvdnatcadtvynaikvgyrlfdaamdygnckeigeginra
ldeglvardelfitsklwnsyhdpknvelalkkvlsdmkldyidlflihfpiafkfvpfe
ekyppafycgdgdnfhyedvplletwkamekltkggkaksigisnfsaaliydllrgaei
kpavlqiehhpylqqprlieyvqsqgiaitayssfgpqsflelkhskaldtptlfehkti
tsiadkykktpaqvllrwasqrdiaiipksnnpdrllqnlevndfnlskedfdeiskldq
dlrfnnpwdwdtknripifa

SCOPe Domain Coordinates for d5zcib1:

Click to download the PDB-style file with coordinates for d5zcib1.
(The format of our PDB-style files is described here.)

Timeline for d5zcib1:

  • d5zcib1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5zcib2
View in 3D
Domains from other chains:
(mouse over for more information)
d5zcia_