Lineage for d6fytb_ (6fyt B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (126 PDB entries)
  8. 3060012Domain d6fytb_: 6fyt B: [360074]
    Other proteins in same PDB: d6fyta_, d6fyti_
    automated match to d1rd8b_
    complexed with bma, fuc, nag

Details for d6fytb_

PDB Entry: 6fyt (more details), 2.8 Å

PDB Description: structure of h1 (a/solomon islands/3/06) influenza hemagglutinin in complex with sd38
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6fytb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fytb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki

SCOPe Domain Coordinates for d6fytb_:

Click to download the PDB-style file with coordinates for d6fytb_.
(The format of our PDB-style files is described here.)

Timeline for d6fytb_:

  • d6fytb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08