Lineage for d5yitb_ (5yit B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493182Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2493183Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2493276Family c.123.1.0: automated matches [267628] (1 protein)
    not a true family
  6. 2493277Protein automated matches [267679] (4 species)
    not a true protein
  7. 3059943Species Mycobacterium tuberculosis [TaxId:83332] [360005] (3 PDB entries)
  8. 3060002Domain d5yitb_: 5yit B: [360064]
    automated match to d4ed9a_

Details for d5yitb_

PDB Entry: 5yit (more details), 2.79 Å

PDB Description: crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis
PDB Compounds: (B:) CoA transferase III

SCOPe Domain Sequences for d5yitb_:

Sequence, based on SEQRES records: (download)

>d5yitb_ c.123.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
snpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrppla
tyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnp
nliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvla
qavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakrrkg
vgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinyaelt
aelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadtitvi
rtparyasfravvtdppptagehnavfl

Sequence, based on observed residues (ATOM records): (download)

>d5yitb_ c.123.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
snpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitstyflpnnrg
kksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyarlta
yggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvlaqavlaallh
rerngvadvvqvamydvavglqanqlmmhlnratqpsdafrtadgyivisayvpkhwqkl
cyligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmaclaht
wkqvvdtplfaendltlevgtitvirtparyasfravvtdppptagehnavfl

SCOPe Domain Coordinates for d5yitb_:

Click to download the PDB-style file with coordinates for d5yitb_.
(The format of our PDB-style files is described here.)

Timeline for d5yitb_:

  • d5yitb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08