SCOPe 2.08: Domain d1d6ha2: 1d6h A:236-389

Lineage for d1d6ha2 (1d6h A:236-389)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein Chalcone synthase, C-terminal domain [419031] (1 species)
7. Species Alfalfa (Medicago sativa) [TaxId:3879] [419515] (16 PDB entries)
   Uniprot P30074

8. Domain d1d6ha2: 1d6h A:236-389 [36006]
   Other proteins in same PDB: d1d6ha1
   complexed with coa, so4; mutant

Details for d1d6ha2

PDB Entry: 1d6h, 2.15 Å

PDB Description: chalone synthase (n336a mutant complexed with coa)

PDB Compounds: (A:) chalcone synthase

SCOPe Domain Sequences for d1d6ha2:

Sequence; same for both SEQRES and ATOM records:

>d1d6ha2 c.95.1.2 (A:236-389) Chalcone synthase, C-terminal domain {Alfalfa (Medicago sativa) [TaxId: 3879]}
ifemvwtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygamssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai

Timeline for d1d6ha2:

• d1d6ha2 first appeared (with stable ids) in SCOP 1.55
  
• d1d6ha2 appears in SCOPe 2.07