SCOP 1.71: Domain d1d6ha1: 1d6h A:3-235

Lineage for d1d6ha1 (1d6h A:3-235)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)

6. Protein Chalcone synthase [53915] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)

8. Domain d1d6ha1: 1d6h A:3-235 [36005]

Details for d1d6ha1

PDB Entry: 1d6h, 2.15 Å

PDB Description: chalone synthase (n336a mutant complexed with coa)

SCOP Domain Sequences for d1d6ha1:

Sequence; same for both SEQRES and ATOM records:

>d1d6ha1 c.95.1.2 (A:3-235) Chalcone synthase {Alfalfa (Medicago sativa)}
svseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcdk
smikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpks
kithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgafaggtvlrlakdlaennk
garvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekp

Timeline for d1d6ha1:

• d1d6ha1 first appeared (with stable ids) in SCOP 1.55
  
• d1d6ha1 appears in SCOP 1.69
  
• d1d6ha1 appears in SCOP 1.73
  
• d1d6ha1 appears in the current release, SCOPe 2.08