Lineage for d5zz7a1 (5zz7 A:3-79)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695177Species Thermotoga maritima [TaxId:243274] [360039] (3 PDB entries)
  8. 2695184Domain d5zz7a1: 5zz7 A:3-79 [360044]
    Other proteins in same PDB: d5zz7a2, d5zz7b2
    automated match to d1r72e3
    complexed with gol, nai

Details for d5zz7a1

PDB Entry: 5zz7 (more details), 2.45 Å

PDB Description: redox-sensing transcriptional repressor rex
PDB Compounds: (A:) Redox-sensing transcriptional repressor Rex 1

SCOPe Domain Sequences for d5zz7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zz7a1 a.4.5.0 (A:3-79) automated matches {Thermotoga maritima [TaxId: 243274]}
ekipkpvskrlvsyymclerlldegvevvsseelarrldlkasqirkdlsyfgefgkrgv
gynvehlydaigeilgv

SCOPe Domain Coordinates for d5zz7a1:

Click to download the PDB-style file with coordinates for d5zz7a1.
(The format of our PDB-style files is described here.)

Timeline for d5zz7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zz7a2