Lineage for d5ypsc_ (5yps C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010445Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 3010446Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 3010460Family d.305.1.0: automated matches [196445] (1 protein)
    not a true family
  6. 3010461Protein automated matches [196446] (6 species)
    not a true protein
  7. 3010485Species Pneumocystis carinii [TaxId:1408658] [360017] (1 PDB entry)
  8. 3010488Domain d5ypsc_: 5yps C: [360029]
    automated match to d5gpla_
    complexed with 1pe, ca, gol, peg, pge

Details for d5ypsc_

PDB Entry: 5yps (more details), 2.1 Å

PDB Description: the structural basis of histone chaperonevps75
PDB Compounds: (C:) Vacuolar protein sorting-associated protein 75

SCOPe Domain Sequences for d5ypsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ypsc_ d.305.1.0 (C:) automated matches {Pneumocystis carinii [TaxId: 1408658]}
tsldevadielefekadvellkhqvelfnplyekramvlrkipkfwpiaieaapsdelsv
yispedanvlehlidlrvyrpnedprdikivfefeaneylesnslylmklfryssqkaea
sssninkepsqlisekvniewkknkdltrqtkgtapsfftwfswtgkendifedeeelai
fiaedlypnavkyftdalqen

SCOPe Domain Coordinates for d5ypsc_:

Click to download the PDB-style file with coordinates for d5ypsc_.
(The format of our PDB-style files is described here.)

Timeline for d5ypsc_: