Lineage for d5z0qa_ (5z0q A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504713Species Erwinia tasmaniensis [TaxId:465817] [360026] (1 PDB entry)
  8. 2504714Domain d5z0qa_: 5z0q A: [360027]
    automated match to d4dq6a_
    complexed with plp

Details for d5z0qa_

PDB Entry: 5z0q (more details), 2.77 Å

PDB Description: crystal structure of ovob
PDB Compounds: (A:) Aminotransferase, class I and II

SCOPe Domain Sequences for d5z0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z0qa_ c.67.1.0 (A:) automated matches {Erwinia tasmaniensis [TaxId: 465817]}
fnfdqridrrhsdslkwkkyadrdilplwiadtdfraadciidalqqrvqqgvfgygvts
ealaevaiermesrfgwkiqpewlvflpgvvtginiavrafteahqstvsatpiyppffl
apklagrqhlsaalrleqqrwvldldshedrmsgnekllllcnphnpggtvyrrkeleaq
lrfaqrhdllvcsdeihcdlvlepgvqhipfaslsddaaqrsitlmspsksfniaglgas
lavipnpelrarfnrmrkgmvpdvdvlayvaasaawregqpwldaqldylranrdmlaqh
vnrlpglsmvtpeasflgwidasglgvadpalffekhglgfssgrdfgndrfvrfnfgcp
rqlleealqrmtralt

SCOPe Domain Coordinates for d5z0qa_:

Click to download the PDB-style file with coordinates for d5z0qa_.
(The format of our PDB-style files is described here.)

Timeline for d5z0qa_: