Lineage for d6gffm_ (6gff M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760927Domain d6gffm_: 6gff M: [360023]
    Other proteins in same PDB: d6gffb_, d6gffd_, d6gfff_, d6gffh_, d6gffk2, d6gffl_, d6gffn_
    automated match to d1igml_

Details for d6gffm_

PDB Entry: 6gff (more details), 3.1 Å

PDB Description: structure of garp (lrrc32) in complex with latent tgf-beta1 and mhg-8 fab
PDB Compounds: (M:) MHG-8 Fab light chain

SCOPe Domain Sequences for d6gffm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gffm_ b.1.1.0 (M:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqvtqsssylsvslgdrvtitckasdhiknwlawyqqkpgiaprllvsgatsleagvps
rfsgsgsgknftlsitslqtedvatyycqqywstpwtfgggttl

SCOPe Domain Coordinates for d6gffm_:

Click to download the PDB-style file with coordinates for d6gffm_.
(The format of our PDB-style files is described here.)

Timeline for d6gffm_: