Lineage for d1d6ia1 (1d6i A:2-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917079Protein Chalcone synthase, N-terminal domain [419030] (1 species)
  7. 2917080Species Alfalfa (Medicago sativa) [TaxId:3879] [419514] (16 PDB entries)
    Uniprot P30074
  8. 2917103Domain d1d6ia1: 1d6i A:2-235 [36001]
    Other proteins in same PDB: d1d6ia2, d1d6ib2
    complexed with so4; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1d6ia1

PDB Entry: 1d6i (more details), 2 Å

PDB Description: chalcone synthase (h303q mutant)
PDB Compounds: (A:) chalcone synthase

SCOPe Domain Sequences for d1d6ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ia1 c.95.1.2 (A:2-235) Chalcone synthase, N-terminal domain {Alfalfa (Medicago sativa) [TaxId: 3879]}
vsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcd
ksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpk
skithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaenn
kgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekp

SCOPe Domain Coordinates for d1d6ia1:

Click to download the PDB-style file with coordinates for d1d6ia1.
(The format of our PDB-style files is described here.)

Timeline for d1d6ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d6ia2