Lineage for d6hjfb1 (6hjf B:45-393)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508201Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2508202Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2508316Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2508317Protein automated matches [190491] (16 species)
    not a true protein
  7. 2508379Species Trypanosoma cruzi [TaxId:5693] [267764] (5 PDB entries)
  8. 3059939Domain d6hjfb1: 6hjf B:45-393 [360001]
    Other proteins in same PDB: d6hjfa2, d6hjfb2
    automated match to d1w62a_
    complexed with shf

Details for d6hjfb1

PDB Entry: 6hjf (more details), 1.7 Å

PDB Description: trypanosoma cruzi proline racemase in complex with inhibitor broxopa
PDB Compounds: (B:) Proline racemase A

SCOPe Domain Sequences for d6hjfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hjfb1 d.21.1.0 (B:45-393) automated matches {Trypanosoma cruzi [TaxId: 5693]}
sftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgimleprghddmfga
flfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpakatnvpvvldtpa
glvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffaivp
aeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcveiygpptnpeany
knvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgeerip
gvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlkq

SCOPe Domain Coordinates for d6hjfb1:

Click to download the PDB-style file with coordinates for d6hjfb1.
(The format of our PDB-style files is described here.)

Timeline for d6hjfb1:

  • d6hjfb1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6hjfb2