Lineage for d6mu9a_ (6mu9 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014307Species Bacillus megaterium [TaxId:592022] [359999] (1 PDB entry)
  8. 3014308Domain d6mu9a_: 6mu9 A: [360000]
    automated match to d3p09a_
    complexed with so4

Details for d6mu9a_

PDB Entry: 6mu9 (more details), 0.97 Å

PDB Description: beta-lactamase penicillinase from bacillus megaterium
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6mu9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mu9a_ e.3.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 592022]}
tksdrefakledkydanlgvfaldtgtnktvtyhpderfayasthkalavgallqqksie
dlnerifytrddlvnynpitekhvdtgmtlreladaslrysdntagnlilqqldgpdgfk
ealekigdnvtlperfepdlnevnpgethdtstpralaaslqkyvlgqalpedkralltd
wmkrnttgdaliragvpkswevadktgagsyatrndiailwppngdpivlailsnrtekd
aeyndkliaeaakqavktlkitr

SCOPe Domain Coordinates for d6mu9a_:

Click to download the PDB-style file with coordinates for d6mu9a_.
(The format of our PDB-style files is described here.)

Timeline for d6mu9a_: