Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Bacillus megaterium [TaxId:592022] [359999] (1 PDB entry) |
Domain d6mu9a_: 6mu9 A: [360000] automated match to d3p09a_ complexed with so4 |
PDB Entry: 6mu9 (more details), 0.97 Å
SCOPe Domain Sequences for d6mu9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mu9a_ e.3.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 592022]} tksdrefakledkydanlgvfaldtgtnktvtyhpderfayasthkalavgallqqksie dlnerifytrddlvnynpitekhvdtgmtlreladaslrysdntagnlilqqldgpdgfk ealekigdnvtlperfepdlnevnpgethdtstpralaaslqkyvlgqalpedkralltd wmkrnttgdaliragvpkswevadktgagsyatrndiailwppngdpivlailsnrtekd aeyndkliaeaakqavktlkitr
Timeline for d6mu9a_: