Lineage for d6iijc_ (6iij C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410109Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2410393Protein automated matches [190854] (17 species)
    not a true protein
  7. 3059918Species Coxsackievirus a10 [TaxId:42769] [359980] (5 PDB entries)
  8. 3059928Domain d6iijc_: 6iij C: [359990]
    Other proteins in same PDB: d6iija_, d6iijb_
    automated match to d5yhqc_
    complexed with sph

Details for d6iijc_

PDB Entry: 6iij (more details), 2.84 Å

PDB Description: cryo-em structure of cv-a10 mature virion
PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d6iijc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iijc_ b.121.4.1 (C:) automated matches {Coxsackievirus a10 [TaxId: 42769]}
gipaelrpgtnqflttdddtaapilpgftptptihipgevhsllelcrvetilevnntte
atgltrllipvssqnkadelcaafmvdpgrigpwqstlvgqicryytqwsgslkvtfmft
gsfmatgkmlvaysppgsaqpanretamlgthviwdfglqssvslvipwisnthfrtakt
ggnydyytagvvtlwyqtnyvvppetpgeayiiamgaaqdnftlkickdtdevtqqavlq

SCOPe Domain Coordinates for d6iijc_:

Click to download the PDB-style file with coordinates for d6iijc_.
(The format of our PDB-style files is described here.)

Timeline for d6iijc_:

  • d6iijc_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08