Lineage for d6miba_ (6mib A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (28 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1049 PDB entries)
  8. 3059920Domain d6miba_: 6mib A: [359982]
    automated match to d3repa_
    mutant

Details for d6miba_

PDB Entry: 6mib (more details), 1.8 Å

PDB Description: crystal structure of the ilk atp-binding deficient mutant (l207w) /alpha-parvin core complex
PDB Compounds: (A:) Integrin-linked protein kinase

SCOPe Domain Sequences for d6miba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6miba_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkhsgidfkqlnfltklnenhsgewwkgrwqgndivvkvlkvrdwstrksrdfneecprl
rifshpnvlpvlgacqsppaphptlithwmpygslynvlhegtnfvvdqsqavkfaldma
rgmaflhtlepliprhalnsrsvmidedmtarismadvkfsfqspgrmyapawvapealq
kkpedtnrrsadmwsfavllwelvtrevpfadlsnmeigmkvaleglrptippgisphvs
klmkicmnedpakrpkfdmivpilekmqdk

SCOPe Domain Coordinates for d6miba_:

Click to download the PDB-style file with coordinates for d6miba_.
(The format of our PDB-style files is described here.)

Timeline for d6miba_:

  • d6miba_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08