Lineage for d6ilia_ (6ili A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535541Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2535542Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)
  7. 2535543Species Human (Homo sapiens) [TaxId:9606] [103208] (36 PDB entries)
  8. 3059917Domain d6ilia_: 6ili A: [359979]
    automated match to d5ghna_
    protein/DNA complex; complexed with 8dg; mutant

Details for d6ilia_

PDB Entry: 6ili (more details), 1.45 Å

PDB Description: crystal structure of human mth1(g2k/d120n mutant) in complex with 8- oxo-dgtp at ph 6.5
PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d6ilia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ilia_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdn
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d6ilia_:

Click to download the PDB-style file with coordinates for d6ilia_.
(The format of our PDB-style files is described here.)

Timeline for d6ilia_:

  • d6ilia_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08