Lineage for d6fywa_ (6fyw A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2370862Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2370863Protein Hemagglutinin [49824] (13 species)
    includes rudiment esterase domain
  7. 3059899Species Influenza b virus (b/brisbane/60/2008) [TaxId:604436] [359961] (1 PDB entry)
  8. 3059900Domain d6fywa_: 6fyw A: [359962]
    automated match to d3bt6a_
    complexed with bma, gol, man, nag

Details for d6fywa_

PDB Entry: 6fyw (more details), 2.2 Å

PDB Description: structure of b/brisbane/60/2008 influenza hemagglutinin in complex with sd83
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6fywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fywa_ b.19.1.2 (A:) Hemagglutinin {Influenza b virus (b/brisbane/60/2008) [TaxId: 604436]}
tgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtetrgklcpkclnctdld
valgrpkctgkipsarvsilhevrpvtsgcfpimhdrtkirqlpnllrgyehirlsthnv
inaenapggpykigtsgscpnitngngffatmawavpkndknktatnpltievpyicteg
edqitvwgfhsdnetqmaklygdskpqkftssangvtthyvsqiggfpnqtedgglpqsg
rivvdymvqksgktgtityqrgillpqkvwcasgrskvikgslpligeadclhekyggln
kskpyytgehakaigncpiwvktplklangtkyrpp

SCOPe Domain Coordinates for d6fywa_:

Click to download the PDB-style file with coordinates for d6fywa_.
(The format of our PDB-style files is described here.)

Timeline for d6fywa_:

  • d6fywa_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08