Lineage for d6fyta_ (6fyt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776381Species Influenza A virus (a/solomon islands/3/2006(h1n1)) [TaxId:464623] [343253] (2 PDB entries)
  8. 2776382Domain d6fyta_: 6fyt A: [359960]
    Other proteins in same PDB: d6fytb_, d6fyti_
    automated match to d5t0ba_
    complexed with nag

Details for d6fyta_

PDB Entry: 6fyt (more details), 2.8 Å

PDB Description: structure of h1 (a/solomon islands/3/06) influenza hemagglutinin in complex with sd38
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6fyta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fyta_ b.19.1.0 (A:) automated matches {Influenza A virus (a/solomon islands/3/2006(h1n1)) [TaxId: 464623]}
gdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgncsvag
wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
hppnigdqralyhkenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdti
ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
gecpkyvrsaklrmvtglrnip

SCOPe Domain Coordinates for d6fyta_:

Click to download the PDB-style file with coordinates for d6fyta_.
(The format of our PDB-style files is described here.)

Timeline for d6fyta_: