Lineage for d6h39m_ (6h39 M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994123Domain d6h39m_: 6h39 M: [359954]
    Other proteins in same PDB: d6h39b_, d6h39c1, d6h39c2, d6h39d_, d6h39e_, d6h39f_, d6h39g_, d6h39i_, d6h39j_, d6h39k_, d6h39l_, d6h39n_, d6h39o_, d6h39p_, d6h39q1, d6h39q2, d6h39r_, d6h39s_, d6h39t_, d6h39u_, d6h39w_, d6h39x_, d6h39y_, d6h39z_
    automated match to d4j70m_
    complexed with cl, fgy, mes, mg, so4

Details for d6h39m_

PDB Entry: 6h39 (more details), 2.5 Å

PDB Description: yeast 20s proteasome in complex with the peptidic non-covalent binding inhibitor rts-v5
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6h39m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h39m_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d6h39m_:

Click to download the PDB-style file with coordinates for d6h39m_.
(The format of our PDB-style files is described here.)

Timeline for d6h39m_: