Lineage for d6glzb1 (6glz B:2-126)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503073Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2503459Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2503460Protein automated matches [191164] (22 species)
    not a true protein
  7. 2503464Species Clostridium pasteurianum [TaxId:1501] [279203] (15 PDB entries)
  8. 3059889Domain d6glzb1: 6glz B:2-126 [359951]
    Other proteins in same PDB: d6glza2, d6glza3, d6glza4, d6glzb2, d6glzb3
    automated match to d3c8ya2
    complexed with 402, fes, mg, sf4

Details for d6glzb1

PDB Entry: 6glz (more details), 2.02 Å

PDB Description: [fefe]-hydrogenase cpi from clostridium pasteurianum, variant c299d
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d6glzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6glzb1 d.15.4.0 (B:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
kpflp

SCOPe Domain Coordinates for d6glzb1:

Click to download the PDB-style file with coordinates for d6glzb1.
(The format of our PDB-style files is described here.)

Timeline for d6glzb1:

  • d6glzb1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08